PDB entry 1p94

View 1p94 on RCSB PDB site
Description: NMR Structure of ParG symmetric dimer
Class: cell cycle
Keywords: ribbon-helix-helix, dimer, DNA binding, CELL CYCLE
Deposited on 2003-05-09, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmid partition protein ParG
    Species: Salmonella enterica [TaxId:28901]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p94a_
  • Chain 'B':
    Compound: plasmid partition protein ParG
    Species: Salmonella enterica [TaxId:28901]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p94b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p94A (A:)
mslekahtsvkkmtfgenrdlervvtapvssgkikrvnvnfdeekhtrfkaacarkgtsi
tdvvnqlvdnwlkene

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p94B (B:)
mslekahtsvkkmtfgenrdlervvtapvssgkikrvnvnfdeekhtrfkaacarkgtsi
tdvvnqlvdnwlkene