PDB entry 1p91

View 1p91 on RCSB PDB site
Description: Crystal Structure of RlmA(I) enzyme: 23S rRNA n1-G745 methyltransferase (NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ER19)
Class: transferase
Keywords: RlmA, RrmA, methyltransferase, G745, ER19, 23S rRNA, NESG, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, transferase
Deposited on 2003-05-08, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal RNA large subunit methyltransferase A
    Species: Escherichia coli [TaxId:562]
    Gene: RRMA OR B1822
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36999 (Start-268)
      • modified residue (28)
      • modified residue (53-54)
      • modified residue (148)
      • modified residue (184)
      • modified residue (219)
      • modified residue (232)
    Domains in SCOPe 2.08: d1p91a_
  • Chain 'B':
    Compound: Ribosomal RNA large subunit methyltransferase A
    Species: Escherichia coli [TaxId:562]
    Gene: RRMA OR B1822
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36999 (Start-268)
      • modified residue (28)
      • modified residue (53-54)
      • modified residue (148)
      • modified residue (184)
      • modified residue (219)
      • modified residue (232)
    Domains in SCOPe 2.08: d1p91b_
  • Heterogens: ZN, SO4, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p91A (A:)
    msfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarra
    fldaghyqplrdaivaqlrerlddkatavldigcgegyythafadalpeittfgldvskv
    aikaaakrypqvtfcvasshrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpg
    prhlmelkgliynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawra
    kpevwqtlaakevfdcqtdfnihlwqrsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p91A (A:)
    sfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarraf
    ldaghyqplrdaivaqlrerlddkatavldigcgegyythafadalpeittfgldvskva
    ikaaakrypqvtfcvasshrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpgp
    rhlmelkgliynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawrak
    pevwqtlaakevfdcqtdfnihlwqrsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p91B (B:)
    msfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarra
    fldaghyqplrdaivaqlrerlddkatavldigcgegyythafadalpeittfgldvskv
    aikaaakrypqvtfcvasshrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpg
    prhlmelkgliynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawra
    kpevwqtlaakevfdcqtdfnihlwqrsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p91B (B:)
    sfscplchqplsreknsyicpqrhqfdmakegyvnllpdsaemmqarrafldaghyqplr
    daivaqlrerlddkatavldigcgegyythafadalpeittfgldvskvaikaaakrypq
    vtfcvasshrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpgprhlmelkgli
    ynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawrakpevwqtlaak
    evfdcqtdfnihlwqrsy