PDB entry 1p90

View 1p90 on RCSB PDB site
Description: The Three-dimensional Structure of the Core Domain of NafY from Azotobacter vinelandii determined at 1.8 resolution
Class: protein binding
Keywords: Ribonuclease H motif, PROTEIN BINDING
Deposited on 2003-05-08, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Azotobacter vinelandii [TaxId:354]
    Gene: NafY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p90a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p90A (A:)
    ervpegsirvaiasnngeqldghfgsclrflvyqvsakdaslvdirstldvalaedknaw
    rveqiqdcqvlyvvsiggpaaakvvragihplkkpkgcaaqeaiaelqtvmagspppwla
    klvgvsaeervrfsvsddedeaara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p90A (A:)
    ervpegsirvaiasnngeqldghfgsclrflvyqvsakdaslvdirstldvalaedknaw
    rveqiqdcqvlyvvsiggpaaakvvragihplkkpkgcaaqeaiaelqtvmagspppwla
    klv