PDB entry 1p90

View 1p90 on RCSB PDB site
Description: The Three-dimensional Structure of the Core Domain of NafY from Azotobacter vinelandii determined at 1.8 resolution
Deposited on 2003-05-08, released 2003-08-19
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p90a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p90A (A:)
    ervpegsirvaiasnngeqldghfgsclrflvyqvsakdaslvdirstldvalaedknaw
    rveqiqdcqvlyvvsiggpaaakvvragihplkkpkgcaaqeaiaelqtvmagspppwla
    klvgvsaeervrfsvsddedeaara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p90A (A:)
    ervpegsirvaiasnngeqldghfgsclrflvyqvsakdaslvdirstldvalaedknaw
    rveqiqdcqvlyvvsiggpaaakvvragihplkkpkgcaaqeaiaelqtvmagspppwla
    klv