PDB entry 1p8k

View 1p8k on RCSB PDB site
Description: The structure and DNA recognition of a bifunctional homing endonuclease and group I intron splicing factor
Class: hydrolase/DNA
Keywords: hydrolase/DNA
Deposited on 2003-05-07, released 2004-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(p*gp*cp*gp*cp*gp*cp*tp*gp*ap*gp*gp*ap*gp*gp*tp*tp*tp*c)-3'
  • Chain 'B':
    Compound: 5'-d(p*tp*cp*tp*gp*tp*ap*ap*ap*gp*cp*gp*cp*a)-3'
  • Chain 'C':
    Compound: 5'-d(p*gp*cp*gp*cp*tp*tp*tp*ap*cp*ap*gp*ap*gp*ap*ap*a)-3'
  • Chain 'D':
    Compound: 5'-d(p*cp*cp*tp*cp*cp*tp*cp*ap*gp*cp*gp*cp*gp*cp*t)-3'
  • Chain 'Z':
    Compound: Intron-encoded endonuclease I-AniI
    Species: Emericella nidulans [TaxId:162425]
    Gene: Aspergillus nidulans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03880 (2-253)
      • cloning artifact (0-1)
      • see remark 999 (60)
      • modified residue (65)
      • modified residue (89)
    Domains in SCOPe 2.06: d1p8kz1, d1p8kz2, d1p8kz3
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8kZ (Z:)
    gsdltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrk
    rneiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytr
    sdeplnsiesiintsyfsawlvgfieaegcfsvyklnkdddyliasfdiaqrdgdilisa
    irkylsfttkvyldktncsklkvtsvrsveniikflqnapvkllgnkklqyllwlkqlrk
    isrysekikipsny