PDB entry 1p8k

View 1p8k on RCSB PDB site
Description: The structure and DNA recognition of a bifunctional homing endonuclease and group I intron splicing factor
Deposited on 2003-05-07, released 2004-01-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8kZ (Z:)
    gsdltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrk
    rneiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytr
    sdeplnsiesiintsyfsawlvgfieaegcfsvyklnkdddyliasfdiaqrdgdilisa
    irkylsfttkvyldktncsklkvtsvrsveniikflqnapvkllgnkklqyllwlkqlrk
    isrysekikipsny