PDB entry 1p8j

View 1p8j on RCSB PDB site
Description: crystal structure of the proprotein convertase furin
Deposited on 2003-05-07, released 2003-07-08
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p8jA (A:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jA (A:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p8jB (B:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jB (B:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtape
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p8jC (C:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jC (C:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p8jD (D:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jD (D:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1p8jE (E:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jE (E:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1p8jF (F:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jF (F:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1p8jG (G:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jG (G:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p8jH (H:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jH (H:)
    yqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnad
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevrk
    avtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgfn
    dwafmtthswdedpagewvleientseannygtltkftlvlygtap