PDB entry 1p8j

View 1p8j on RCSB PDB site
Description: crystal structure of the proprotein convertase furin
Class: hydrolase/hydrolase inhibitor
Keywords: prohormone convertase, spc1, pace, p-domain, chloromethylketone, hydrolase-hydrolase inhibitor complex
Deposited on 2003-05-07, released 2003-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8ja1, d1p8ja2
  • Chain 'B':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8jb1, d1p8jb2
  • Chain 'C':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8jc1, d1p8jc2
  • Chain 'D':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8jd1, d1p8jd2
  • Chain 'E':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8je1, d1p8je2
  • Chain 'F':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8jf1, d1p8jf2
  • Chain 'G':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8jg1, d1p8jg2
  • Chain 'H':
    Compound: Furin precursor
    Species: Mus musculus [TaxId:10090]
    Gene: FURIN OR FUR OR PCSK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p8jh1, d1p8jh2
  • Chain 'J':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'K':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'L':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'M':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'N':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'P':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'Q':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Chain 'R':
    Compound: decanoyl-arg-val-lys-arg-chloromethylketone inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1P8J (0-5)
  • Heterogens: NAG, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p8jA (A:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jA (A:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p8jB (B:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jB (B:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtape
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p8jC (C:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jC (C:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p8jD (D:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jD (D:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1p8jE (E:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jE (E:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1p8jF (F:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jF (F:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1p8jG (G:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jG (G:)
    vyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnyd
    pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
    gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
    fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
    kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
    ddwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevr
    kavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgf
    ndwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p8jH (H:)
    dvyqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagny
    dpgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrml
    dgevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgs
    ifvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqn
    ekqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahln
    addwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlev
    rkavtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadg
    fndwafmtthswdedpagewvleientseannygtltkftlvlygtapegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8jH (H:)
    yqeptdpkfpqqwylsgvtqrdlnvkeawaqgftghgivvsilddgieknhpdlagnydp
    gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
    evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
    vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
    qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnad
    dwatngvgrkvshsygyglldagamvalaqnwttvapqrkciveilvepkdigkrlevrk
    avtaclgepnhitrlehvqarltlsynrrgdlaihlispmgtrstllaarphdysadgfn
    dwafmtthswdedpagewvleientseannygtltkftlvlygtap
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.