PDB entry 1p8g

View 1p8g on RCSB PDB site
Description: The solution structure of apo CopZ from Bacillus subtilis
Class: chaperone
Keywords: M-X-C-X-X-C motif, beta-alpha-beta-beta-alpha-beta secondary structure, copper chaperone
Deposited on 2003-05-07, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to mercuric transport protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bscopz
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32221 (0-68)
      • cloning artifact (69-72)
    Domains in SCOPe 2.06: d1p8ga1, d1p8ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8gA (A:)
    meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
    edqgydvakiegr