PDB entry 1p8f

View 1p8f on RCSB PDB site
Description: A four location model to explain the stereospecificity of proteins.
Class: oxidoreductase
Keywords: isocitrate dehydrogenase, d-isocitrate, enantiomer, stereospecificity, four-location, racemic, magnesium ion, Oxidoreductase
Deposited on 2003-05-07, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Escherichia coli [TaxId:562]
    Gene: ICD OR ICDA OR ICDE OR B1136
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p8fa_
  • Heterogens: SO4, MG, ICT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8fA (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm