PDB entry 1p8c

View 1p8c on RCSB PDB site
Description: Crystal structure of TM1620 (APC4843) from Thermotoga maritima
Class: structural genomics, unknown function
Keywords: Conserved hypothetical protein, Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-05-06, released 2003-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p8ca_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p8cb_
  • Chain 'C':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p8cc_
  • Chain 'D':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p8cd_
  • Chain 'E':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p8ce_
  • Chain 'F':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p8cf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p8cA (A:)
    mgsshhhhhhssgrenlyfqghmeykkfvearrelnekvlsrgtlntkrffnldsavyrp
    gkldvktkelmglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviph
    lrravgfleelremekngetislgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8cA (A:)
    rrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvr
    cvqegasdeeifealdialvvggsiviphlrravgfleelremekngetis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p8cB (B:)
    mgsshhhhhhssgrenlyfqghmeykkfvearrelnekvlsrgtlntkrffnldsavyrp
    gkldvktkelmglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviph
    lrravgfleelremekngetislgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8cB (B:)
    ykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddc
    iryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p8cC (C:)
    mgsshhhhhhssgrenlyfqghmeykkfvearrelnekvlsrgtlntkrffnldsavyrp
    gkldvktkelmglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviph
    lrravgfleelremekngetislgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8cC (C:)
    eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
    ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p8cD (D:)
    mgsshhhhhhssgrenlyfqghmeykkfvearrelnekvlsrgtlntkrffnldsavyrp
    gkldvktkelmglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviph
    lrravgfleelremekngetislgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8cD (D:)
    eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
    ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngeti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1p8cE (E:)
    mgsshhhhhhssgrenlyfqghmeykkfvearrelnekvlsrgtlntkrffnldsavyrp
    gkldvktkelmglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviph
    lrravgfleelremekngetislgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8cE (E:)
    eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
    ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetis
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1p8cF (F:)
    mgsshhhhhhssgrenlyfqghmeykkfvearrelnekvlsrgtlntkrffnldsavyrp
    gkldvktkelmglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviph
    lrravgfleelremekngetislgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8cF (F:)
    eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
    ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekng