PDB entry 1p8b

View 1p8b on RCSB PDB site
Description: solution structure of pa1b, a 37-amino acid insecticidal protein extracted from pea seeds (pisum sativum)
Class: plant protein
Keywords: inhibitor cystine-knot
Deposited on 2003-05-06, released 2003-11-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-02, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pea Albumin 1, subunit b
  Species: Pisum sativum
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62927 (0-36)
    • see remark 999 (28)
  Domains in SCOP 1.73: d1p8ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p8bA (A:)
  ascngvcspfemppcgtsacrcipvglvigycrnpsg