PDB entry 1p8b

View 1p8b on RCSB PDB site
Description: solution structure of pa1b, a 37-amino acid insecticidal protein extracted from pea seeds (pisum sativum)
Deposited on 2003-05-06, released 2003-11-25
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1p8ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8bA (A:)
    ascngvcspfemppcgtsacrcipvglvigycrnpsg