PDB entry 1p8a

View 1p8a on RCSB PDB site
Description: Solution structure of the low molecular weight protein tyrosine phosphatase from Tritrichomonas foetus
Class: hydrolase
Keywords: low molecular weight protein tyrosine phosphatase, Tritrichomonas foetus, HYDROLASE
Deposited on 2003-05-06, released 2004-06-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase
    Species: Tritrichomonas foetus [TaxId:5724]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00810 (0-145)
      • engineered (0)
    Domains in SCOPe 2.02: d1p8aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8aA (A:)
    aaekkavlfvclgnicrspacegicrdmvgdkliidsaatsgfhvgqspdtrsqkvcksn
    gvdiskqrarqitkadfskfdviaaldqsilsdinsmkpsncrakvvlfnppngvddpyy
    ssdgfptmfasiskemkpfltehgli