PDB entry 1p8a

View 1p8a on RCSB PDB site
Description: solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus
Deposited on 2003-05-06, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1p8aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p8aA (A:)
    aaekkavlfvclgnicrspacegicrdmvgdkliidsaatsgfhvgqspdtrsqkvcksn
    gvdiskqrarqitkadfskfdviaaldqsilsdinsmkpsncrakvvlfnppngvddpyy
    ssdgfptmfasiskemkpfltehgli