PDB entry 1p89

View 1p89 on RCSB PDB site
Description: Substrate-induced Structural Changes to the Isolated N-Terminal Domain of 5-Enolpyruvylshikimate-3-phosphate Synthase
Deposited on 2003-05-06, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1p89a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p89A (A:)
    snralllaalahgktvltnlldsddvrhmlnaltalgvsytlsadrtrceiignggplha
    egalelflgnagtamrplaaalclgsndivltgeprmkerpighlvdalrlggakityle
    qenypplrlqggftggnvdvdgsvssqfltallmtaplapedtvirikgdlvskpyidit
    lnlmktfgveienqhyqqfvvkggqsyqspgtylve