PDB entry 1p88

View 1p88 on RCSB PDB site
Description: Substrate-induced structural changes to the isolated N-terminal domain of 5-enolpyruvylshikimate-3-phosphate synthase
Class: transferase
Keywords: EPSP synthase, NMR Structure from MOLMOL, Transferase
Deposited on 2003-05-06, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoshikimate 1-carboxyvinyltransferase
    Species: Escherichia coli [TaxId:562]
    Gene: AROA OR B0908 OR Z1254 OR ECS0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p88a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p88A (A:)
    snralllaalahgktvltnlldsddvrhmlnaltalgvsytlsadrtrceiignggplha
    egalelflgnagtamrplaaalclgsndivltgeprmkerpighlvdalrlggakityle
    qenypplrlqggftggnvdvdgsvssqfltallmtaplapedtvirikgdlvskpyidit
    lnlmktfgveienqhyqqfvvkggqsyqspgtylve