PDB entry 1p87

View 1p87 on RCSB PDB site
Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the initiation-like state of E. coli 70S ribosome
Deposited on 2003-05-06, released 2003-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1p87a_
  • Chain 'B':
    Domains in SCOP 1.71: d1p87b_
  • Chain 'C':
    Domains in SCOP 1.71: d1p87c_
  • Chain 'D':
    Domains in SCOP 1.71: d1p87d_
  • Chain 'E':
    Domains in SCOP 1.71: d1p87e_
  • Chain 'F':
    Domains in SCOP 1.71: d1p87f_
  • Chain 'G':
    Domains in SCOP 1.71: d1p87g_
  • Chain 'H':
    Domains in SCOP 1.71: d1p87h_
  • Chain 'I':
    Domains in SCOP 1.71: d1p87i_
  • Chain 'J':
    Domains in SCOP 1.71: d1p87j_
  • Chain 'K':
    Domains in SCOP 1.71: d1p87k_
  • Chain 'L':
    Domains in SCOP 1.71: d1p87l_
  • Chain 'M':
    Domains in SCOP 1.71: d1p87m_
  • Chain 'N':
    Domains in SCOP 1.71: d1p87n_
  • Chain 'O':
    Domains in SCOP 1.71: d1p87o_
  • Chain 'P':
    Domains in SCOP 1.71: d1p87p_
  • Chain 'Q':
    Domains in SCOP 1.71: d1p87q_
  • Chain 'R':
    Domains in SCOP 1.71: d1p87r_
  • Chain 'S':
    Domains in SCOP 1.71: d1p87s_
  • Chain 'T':
    Domains in SCOP 1.71: d1p87t_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p87B (B:)
    atvsmrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkia
    srkgkilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqs
    qdgtfdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgi
    pvfaivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87B (B:)
    mrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkg
    kilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgt
    fdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfa
    ivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p87C (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgeilggmaaveqpekpaaqpkkqqrkgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87C (C:)
    gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
    ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaevrkpeldaklvadsit
    sqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiartewyregrvplhtlrad
    idyntseahttygvigvkvwifkgei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p87D (D:)
    arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
    rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
    aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
    fkrkpersdlsadinehlivelysk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87D (D:)
    rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr
    riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka
    imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf
    krkpersdlsadinehlivelysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1p87E (E:)
    ahiekqagelqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiq
    kamekarrnminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvh
    nvlakaygstnpinvvratidglenmnspemvaakrgksveeilgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87E (E:)
    elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
    nminvalnngtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakayg
    stnpinvvratidglenmnspemvaakr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1p87F (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkhavteaspmvkakderrerrddfanet
    addaeagdseeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87F (F:)
    mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
    lmnveapqevidelettfrfndavirsmvmrtkha
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1p87G (G:)
    prrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkselea
    fevalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrla
    nelsdaaenkgtavkkredvhrmaeankafahyrwlslrsfshqagasskqpalgyln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87G (G:)
    sellakfvnilmvdgkkstaesivysaletlaqrsgkseleafevalenvrptvevksrr
    vggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlanelsdaaenkgtavkkre
    dvhrmaeankafahyrw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p87H (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87H (H:)
    mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
    lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
    geiicyv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1p87I (I:)
    aenqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekl
    dlyitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrka
    rrrpqfskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87I (I:)
    qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
    itvkgggisgqagairhgitralmeydeslrselrkagf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1p87J (J:)
    mqnqririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkd
    ardqyeirthlrlvdiveptektvdalmrldlaagvdvqislg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87J (J:)
    ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
    yeirthlrlvdiveptektvdalmrldlaagvdvqi
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1p87K (K:)
    akapirarkrvrkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpf
    aaqvaaercadavkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngc
    rppkkrrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87K (K:)
    rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
    avkeygiknlevmvkgpgpgrestiralnaagfritnitdv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1p87L (L:)
    atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
    evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
    pka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87L (L:)
    pqkrgvctrvytttpkkpnsalrkvcrvrltngfevtsyiggeghnlqehsvilirggrv
    kdlpgvryhtvrgaldcsgvkdrkqarskygvkrpka
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1p87M (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87M (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1p87N (N:)
    akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
    nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87N (N:)
    phgflrkfglsrikvreaamrgeipglkkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1p87O (O:)
    slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
    qrrklldylkrkdvarytqlierlglrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87O (O:)
    lsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvsq
    rrklldylkrkdvarytqlierlglr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1p87P (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikevnkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87P (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikev
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1p87Q (Q:)
    tdkirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvvei
    recrplsktkswtlvrvvekavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87Q (Q:)
    rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr
    plsktkswtlvrvvekavl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1p87R (R:)
    aryfrrrkfcrftaegvqeidykdiatlknyitesgkivpsritgtrakyqrqlaraikr
    arylsllpytdrhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87R (R:)
    qeidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1p87S (S:)
    prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
    vtdemvghklgefaptrtyrghaadkkakkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87S (S:)
    dlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfvtdemvghkl
    gefap
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1p87T (T:)
    aniksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrq
    aakglihknkaarhkanltaqinkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p87T (T:)
    ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak
    glihknkaarhkanltaqinkla