PDB entry 1p7s

View 1p7s on RCSB PDB site
Description: t4 lysozyme core repacking mutant v103i/ta
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, designed core mutant, automated protein design, protein engineering, protein folding, protein stability, core repacking, back revertant, dead-end elimination theorem, side-chain packing, optimized rotamer combinations, orbit
Deposited on 2003-05-05, released 2003-10-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.193
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Enterobacteria phage T4 [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • engineered (53)
    • engineered (96)
    • engineered (102)
  Domains in SCOPe 2.03: d1p7sa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p7sA (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmifqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl