PDB entry 1p7o

View 1p7o on RCSB PDB site
Description: Crystal structure of phospholipase A2 (MIPLA4) from Micropechis ikaheka
Class: hydrolase
Keywords: phospholipase a2, micropechis ikaheka, pancreatic loop, hydrolase
Deposited on 2003-05-05, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Micropechis ikaheka [TaxId:66188]
    Database cross-references and differences (RAF-indexed):
    • PDB 1P7O (0-123)
    Domains in SCOPe 2.07: d1p7oa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Micropechis ikaheka [TaxId:66188]
    Database cross-references and differences (RAF-indexed):
    • PDB 1P7O (0-123)
    Domains in SCOPe 2.07: d1p7ob_
  • Chain 'C':
    Compound: phospholipase a2
    Species: Micropechis ikaheka [TaxId:66188]
    Database cross-references and differences (RAF-indexed):
    • PDB 1P7O (0-123)
    Domains in SCOPe 2.07: d1p7oc_
  • Chain 'D':
    Compound: phospholipase a2
    Species: Micropechis ikaheka [TaxId:66188]
    Database cross-references and differences (RAF-indexed):
    • PDB 1P7O (0-123)
    Domains in SCOPe 2.07: d1p7od_
  • Chain 'E':
    Compound: phospholipase a2
    Species: Micropechis ikaheka [TaxId:66188]
    Database cross-references and differences (RAF-indexed):
    • PDB 1P7O (0-123)
    Domains in SCOPe 2.07: d1p7oe_
  • Chain 'F':
    Compound: phospholipase a2
    Species: Micropechis ikaheka [TaxId:66188]
    Database cross-references and differences (RAF-indexed):
    • PDB 1P7O (0-123)
    Domains in SCOPe 2.07: d1p7of_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7oA (A:)
    nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
    ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
    qlck
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7oB (B:)
    nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
    ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
    qlck
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7oC (C:)
    nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
    ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
    qlck
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7oD (D:)
    nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
    ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
    qlck
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7oE (E:)
    nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
    ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
    qlck
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7oF (F:)
    nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
    ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
    qlck