PDB entry 1p7n

View 1p7n on RCSB PDB site
Description: Dimeric Rous Sarcoma virus Capsid protein structure with an upstream 25-amino acid residue extension of C-terminal of Gag p10 protein
Class: Viral protein
Keywords: Retrovirus, capsid protein, Gag Polyprotein, immature gag, Viral protein
Deposited on 2003-05-02, released 2003-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.26
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag polyprotein capsid protein p27
  Species: Rous sarcoma virus [TaxId:11886]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03322 (4-175)
    • cloning artifact (0-3)
  Domains in SCOPe 2.04: d1p7na_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p7nA (A:)
  gptspgpaltdwarvreelastgppvvampvviktegpawtplepklitrladtvrtkgl
  rspitmaevealmsspllphdvtnlmrvilgpapyalwmdawgvqlqtviaaatrdprhp
  angqgrgertnlnrlkgladgmvgnpqgqaallrpgelvaitasalqafrevarla