PDB entry 1p7m

View 1p7m on RCSB PDB site
Description: solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i
Deposited on 2003-05-02, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p7ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p7mA (A:)
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp