PDB entry 1p7k

View 1p7k on RCSB PDB site
Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)
Class: immune system
Keywords: fab, antibody, anti-DNA antibody, autoantibody, lupus, hepes, immune system
Deposited on 2003-05-02, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody light chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7ka1, d1p7ka2
  • Chain 'B':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JL75 (4-End)
      • cloning artifact (0-3)
      • insertion (51)
      • insertion (82)
      • insertion (82)
      • insertion (103)
      • insertion (103)
      • insertion (103)
    Domains in SCOPe 2.07: d1p7kb1, d1p7kb2, d1p7kb3
  • Chain 'H':
    Compound: antibody heavy chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JL75 (4-End)
      • cloning artifact (0-3)
      • insertion (51)
      • insertion (82)
      • insertion (82)
      • insertion (103)
      • insertion (103)
      • insertion (103)
    Domains in SCOPe 2.07: d1p7kh1, d1p7kh2, d1p7kh3
  • Chain 'L':
    Compound: antibody light chain fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7kl1, d1p7kl2
  • Heterogens: SO4, EPE, 1PE, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7kA (A:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p7kB (B:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7kB (B:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p7kH (H:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7kH (H:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1p7kL (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7kL (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne