PDB entry 1p7i
View 1p7i on RCSB PDB site
Description: crystal structure of engrailed homeodomain mutant k52a
Class: DNA Binding Protein
Keywords: DNA Binding Protein
Deposited on
2003-05-02, released
2003-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Segmentation polarity homeobox protein engrailed
Species: Drosophila melanogaster [TaxId:7227]
Gene: en
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1p7ia_ - Chain 'B':
Compound: Segmentation polarity homeobox protein engrailed
Species: Drosophila melanogaster [TaxId:7227]
Gene: en
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1p7ib_ - Chain 'C':
Compound: Segmentation polarity homeobox protein engrailed
Species: Drosophila melanogaster [TaxId:7227]
Gene: en
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1p7ic_ - Chain 'D':
Compound: Segmentation polarity homeobox protein engrailed
Species: Drosophila melanogaster [TaxId:7227]
Gene: en
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1p7id_ - Heterogens: NHE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1p7iA (A:)
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarakikks
Sequence, based on observed residues (ATOM records): (download)
>1p7iA (A:)
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarak
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1p7iB (B:)
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarakikks
Sequence, based on observed residues (ATOM records): (download)
>1p7iB (B:)
afsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnaraki
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1p7iC (C:)
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarakikks
Sequence, based on observed residues (ATOM records): (download)
>1p7iC (C:)
tafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarak
- Chain 'D':
Sequence, based on SEQRES records: (download)
>1p7iD (D:)
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnarakikks
Sequence, based on observed residues (ATOM records): (download)
>1p7iD (D:)
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnaraki