PDB entry 1p7d

View 1p7d on RCSB PDB site
Description: Crystal structure of the Lambda Integrase (residues 75-356) bound to DNA
Class: DNA Binding Protein/DNA
Keywords: PROTEIN-DNA COMPLEX, DNA Binding Protein/DNA COMPLEX
Deposited on 2003-05-01, released 2003-08-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (0-282)
      • see remark 999 (0)
      • modified residue (268)
    Domains in SCOPe 2.01: d1p7da_
  • Chain 'B':
    Compound: integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: INT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (0-282)
      • see remark 999 (0)
      • modified residue (268)
    Domains in SCOPe 2.01: d1p7db_
  • Chain 'C':
    Compound: 5'-d(*cp*ap*ap*tp*gp*cp*cp*ap*ap*cp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 26-mer
  • Chain 'E':
    Compound: 5'-d(*cp*ap*ap*tp*gp*cp*cp*ap*ap*cp*tp*tp*t)-3'
  • Chain 'F':
    Compound: 26-mer

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p7dA (A:)
    mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
    egkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqaae
    sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
    smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
    sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7dA (A:)
    mtlhswldryekilasrgikqktlinymskikairrglpdaplttkeiaamlngyidegk
    aasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqaaessp
    cwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgismk
    etldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrslsar
    lyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p7dB (B:)
    mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
    egkaasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqaae
    sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
    smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
    sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7dB (B:)
    mtlhswldryekilasrgikqktlinymskikairrglpdaplttkeiaamlngyidegk
    aasaklirstlsdafreaiaeghittnhvaatraaksevrrsrltadeylkiyqaaessp
    cwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgismk
    etldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrslsar
    lyekqisdkfaqhllghksdtmasqyrddrgrewdkieik
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.