PDB entry 1p7b

View 1p7b on RCSB PDB site
Description: Crystal structure of an inward rectifier potassium channel
Class: metal transport
Keywords: transmembrane helices, ion conduction, immunoglobulin fold, cytosolic assembly, METAL TRANSPORT
Deposited on 2003-05-01, released 2003-06-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: 0.295
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integral membrane channel and cytosolic domains
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: chromosome 1 kirbac1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1p7ba1, d1p7ba2
  • Chain 'B':
    Compound: integral membrane channel and cytosolic domains
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: chromosome 1 kirbac1.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1p7bb1, d1p7bb2
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p7bA (A:)
    mnvdpfsphssdsfaqaasparkpprggrriwsgtreviaygmpasvwrdlyywalkvsw
    pvffaslaalfvvnntlfallyqlgdapianqsppgfvgafffsvetlatvgygdmhpqt
    vyahaiatleifvgmsgialstglvfarfarprakimfarhaivrpfngrmtlmvraana
    rqnviaearakmrlmrrehssegyslmkihdlklvrnehpifllgwnmmhvidessplfg
    etpeslaegramllvmiegsdettaqvmqarhawehddirwhhryvdlmsdvdgmthidy
    trfndtepveppgaapdaqafaakpgegdarpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7bA (A:)
    reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
    gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfarprak
    imfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpifllg
    wnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirwhhry
    vdlmthidytrfndtepv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p7bB (B:)
    mnvdpfsphssdsfaqaasparkpprggrriwsgtreviaygmpasvwrdlyywalkvsw
    pvffaslaalfvvnntlfallyqlgdapianqsppgfvgafffsvetlatvgygdmhpqt
    vyahaiatleifvgmsgialstglvfarfarprakimfarhaivrpfngrmtlmvraana
    rqnviaearakmrlmrrehssegyslmkihdlklvrnehpifllgwnmmhvidessplfg
    etpeslaegramllvmiegsdettaqvmqarhawehddirwhhryvdlmsdvdgmthidy
    trfndtepveppgaapdaqafaakpgegdarpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7bB (B:)
    reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
    gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfarprak
    imfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpifllg
    wnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirwhhry
    vdlmthidytrfndtepv