PDB entry 1p7a

View 1p7a on RCSB PDB site
Description: solution structure of the third zinc finger from bklf
Deposited on 2003-04-30, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p7aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7aA (A:)
    gstrgstgikpfqcpdcdrsfsrsdhlalhrkrhmlv