PDB entry 1p73

View 1p73 on RCSB PDB site
Description: Crystal structure of EHV4-TK complexed with TP4A
Class: transferase
Keywords: P-loop, Lid, TRANSFERASE
Deposited on 2003-04-30, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Equid herpesvirus 4 [TaxId:10331]
    Gene: TK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24425 (4-333)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1p73a1, d1p73a2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Equid herpesvirus 4 [TaxId:10331]
    Gene: TK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24425 (4-333)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1p73b1, d1p73b2
  • Chain 'C':
    Compound: Thymidine kinase
    Species: Equid herpesvirus 4 [TaxId:10331]
    Gene: TK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24425 (4-333)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1p73c1, d1p73c2
  • Chain 'D':
    Compound: Thymidine kinase
    Species: Equid herpesvirus 4 [TaxId:10331]
    Gene: TK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24425 (4-333)
      • cloning artifact (2-3)
    Domains in SCOPe 2.07: d1p73d1, d1p73d2
  • Heterogens: SO4, 4TA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p73A (A:)
    gshmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiy
    dtqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfd
    rhpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrar
    igeqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqer
    vspelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaav
    vesllplmsstlsdfdsasaleraartfnaemgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p73A (A:)
    mvtivriyldgvygigksttgrvmassptlyfpepmaywrtlfetdvisgiydtqnrkvd
    daalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpvastvcfpaar
    yllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeqiditliatlr
    nvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspelgdtlfalfk
    tqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesllplmsstlsd
    fdsasaleraartfnaemgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p73B (B:)
    gshmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiy
    dtqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfd
    rhpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrar
    igeqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqer
    vspelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaav
    vesllplmsstlsdfdsasaleraartfnaemgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p73B (B:)
    mvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydtq
    nrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhp
    vastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarige
    qiditliatlrnvyfmlvntchflrsgrvwrdgwgelptsaykhratqmdafqervspel
    gdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesll
    plmsstlsdfdsasaleraartfnaemgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p73C (C:)
    gshmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiy
    dtqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfd
    rhpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrar
    igeqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqer
    vspelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaav
    vesllplmsstlsdfdsasaleraartfnaemgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p73C (C:)
    mvtivriyldgvygigksttgrvmassptlyfpepmaywrtlfetdvisgiydtqnrvdd
    aalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpvastvcfpaary
    llgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrareqiditliatlrnvy
    fmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspelgdtlfalfktqe
    llddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesllplmsstlsdfds
    asaleraartfnaemgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1p73D (D:)
    gshmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiy
    dtqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfd
    rhpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrar
    igeqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqer
    vspelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaav
    vesllplmsstlsdfdsasaleraartfnaemgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p73D (D:)
    hmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydt
    qnravddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpvastv
    cfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeqidit
    liatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspelgdt
    lfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesllplm
    sstlsdfdsasaleraartfnaemgv