PDB entry 1p72

View 1p72 on RCSB PDB site
Description: Crystal structure of EHV4-TK complexed with Thy and ADP
Class: transferase
Keywords: P-loop, Lid, TRANSFERASE
Deposited on 2003-04-30, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Equid herpesvirus 4 [TaxId:10331]
    Gene: TK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24425 (4-333)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d1p72a1, d1p72a2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Equid herpesvirus 4 [TaxId:10331]
    Gene: TK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24425 (4-333)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d1p72b1, d1p72b2
  • Heterogens: SO4, ADP, THM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p72A (A:)
    gshmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiy
    dtqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfd
    rhpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrar
    igeqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqer
    vspelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaav
    vesllplmsstlsdfdsasaleraartfnaemgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p72A (A:)
    shmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiyd
    tqndaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpvastvcfp
    aaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeqiditlia
    tlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspelgdtlfa
    lfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesllplmsst
    lsdfdsasaleraartfnaemgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p72B (B:)
    gshmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiy
    dtqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfd
    rhpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrar
    igeqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqer
    vspelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaav
    vesllplmsstlsdfdsasaleraartfnaemgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p72B (B:)
    shmvtivriyldgvygigksttgrvmasaasptlyfpepmaywrtlfetdvisgiydtqn
    rkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpv
    astvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeq
    iditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspe
    lgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesl
    lplmsstlsdfdsasaleraartfnaemgv