PDB entry 1p6w

View 1p6w on RCSB PDB site
Description: Crystal structure of barley alpha-amylase isozyme 1 (AMY1) in complex with the substrate analogue, methyl 4I,4II,4III-tri-thiomaltotetraoside (thio-DP4)
Class: hydrolase
Keywords: alpha-amylase, barley, isozyme 1, beta-alpha-barrel, sugar tongs binding site, substrate analogue, hydrolase
Deposited on 2003-04-30, released 2003-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Alpha-amylase type A isozyme)
    Species: Hordeum vulgare [TaxId:4513]
    Gene: AMY1.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00693 (0-End)
      • see remark 999 (283)
    Domains in SCOPe 2.08: d1p6wa1, d1p6wa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p6wA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6wA (A:)
    hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
    daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
    phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
    fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
    sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
    fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrngitatsalkilmhe
    gdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek