PDB entry 1p6u

View 1p6u on RCSB PDB site
Description: NMR structure of the BeF3-activated structure of the response regulator Chey2-Mg2+ from Sinorhizobium meliloti
Class: signaling protein
Keywords: CheY2 Beryllium fluoride, chemotaxis, response regulator, signal transduction, activation, Structural Proteomics in Europe, SPINE, Structural Genomics, SIGNALING PROTEIN
Deposited on 2003-04-30, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CheY2
  Species: Sinorhizobium meliloti [TaxId:382]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q52884 (0-128)
  Domains in SCOPe 2.07: d1p6ua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p6uA (A:)
  mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn
  mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa
  ieavfgalk