PDB entry 1p6u

View 1p6u on RCSB PDB site
Description: nmr structure of the bef3-activated structure of the response regulator chey2-mg2+ from sinorhizobium meliloti
Deposited on 2003-04-30, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1p6ua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p6uA (A:)
  mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn
  mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa
  ieavfgalk