PDB entry 1p6t

View 1p6t on RCSB PDB site
Description: Structure characterization of the water soluble region of P-type ATPase CopA from Bacillus subtilis
Class: hydrolase
Keywords: CopA; P-type ATPase; water-soluble region; beta-alpha-beta-beta-alpha-beta fold; NMR, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE
Deposited on 2003-04-30, released 2003-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potential copper-transporting ATPase
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yvgX
  Database cross-references and differences (RAF-indexed):
  • Uniprot O32220 (0-146)
    • engineered (45)
    • cloning artifact (147-150)
  Domains in SCOPe 2.06: d1p6ta1, d1p6ta2, d1p6ta3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p6tA (A:)
  mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
  qekieklgyhvvtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynp
  keasvsdlkeavdklgyklklkgeqdsiegr