PDB entry 1p6s

View 1p6s on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of Human Protein Kinase B beta (Pkb/Akt)
Class: transferase
Keywords: pleckstrin homology domain, pkb, akt, signal transduction
Deposited on 2003-04-30, released 2004-05-18
The last revision prior to the SCOP 1.75 freeze date was dated 2004-05-18, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rac-beta serine/threonine protein kinase
  Species: HOMO SAPIENS
  Gene: AKT2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31751 (0-110)
  Domains in SCOP 1.75: d1p6sa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p6sA (A:)
  mnevsvikegwlhkrgeyiktwrpryfllksdgsfigykerpeapdqtlpplnnfsvaec
  qlmkterprpntfvirclqwttviertfhvdspdereewmraiqmvanslk