PDB entry 1p6s

View 1p6s on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of Human Protein Kinase B beta (Pkb/Akt)
Class: transferase
Keywords: pleckstrin homology domain, pkb, akt, signal transduction, transferase
Deposited on 2003-04-30, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p6sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p6sA (A:)
    mnevsvikegwlhkrgeyiktwrpryfllksdgsfigykerpeapdqtlpplnnfsvaec
    qlmkterprpntfvirclqwttviertfhvdspdereewmraiqmvanslk