PDB entry 1p6r

View 1p6r on RCSB PDB site
Description: Solution structure of the DNA binding domain of the repressor BlaI.
Class: transcription
Keywords: Transcription regulation, Repressor, DNA-binding, Winged Helix Protein, Bacterial resistance to antibiotics
Deposited on 2003-04-30, released 2003-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillinase repressor
    Species: Bacillus licheniformis [TaxId:1402]
    Gene: BLAI OR PENI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p6ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p6rA (A:)
    mkkipqisdaelevmkviwkhssintnevikelsktstwspktiqtmllrlikkgalnhh
    kegrvfvytpnidesdyievks