PDB entry 1p6r

View 1p6r on RCSB PDB site
Description: solution structure of the dna binding domain of the repressor blai.
Deposited on 2003-04-30, released 2003-12-09
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1p6ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p6rA (A:)
    mkkipqisdaelevmkviwkhssintnevikelsktstwspktiqtmllrlikkgalnhh
    kegrvfvytpnidesdyievks