PDB entry 1p6o

View 1p6o on RCSB PDB site
Description: The crystal structure of yeast cytosine deaminase bound to 4(R)-hydroxyl-3,4-dihydropyrimidine at 1.14 angstroms.
Class: hydrolase
Keywords: cytosine deaminase, hydrolase, dimer, inhibitor bound
Deposited on 2003-04-29, released 2003-08-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.112
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: FCY1 OR YPR062W OR YP9499.17
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1p6oa_
  • Chain 'B':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: FCY1 OR YPR062W OR YP9499.17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12178 (3-160)
      • cloning artifact (0-2)
    Domains in SCOP 1.73: d1p6ob_
  • Heterogens: ZN, CA, HPY, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p6oA (A:)
    gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
    gekylqtrghevvvvdderckkimkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6oA (A:)
    tggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlh
    geistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekyl
    qtrghevvvvdderckkimkqfiderpqdwfedige
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p6oB (B:)
    gssmvtggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfksk
    gekylqtrghevvvvdderckkimkqfiderpqdwfedige