PDB entry 1p6f

View 1p6f on RCSB PDB site
Description: Structure of the human natural cytotoxicity receptor NKp46
Deposited on 2003-04-29, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p6fA (A:)
    qqqtlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkv
    kfyipdmnsrmagqysciyrvgelwsepsnlldlvvtemydtptlsvhpgpevisgekvt
    fycrldtatsmflllkegrsshvqrgygkvqaefplgpvttahrgtyrcfgsynnhawsf
    psepvkllvtgdientslapedptfpadtwgtyllttetglqkdhalwdhtaqnllrmgl
    af
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6fA (A:)
    tlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkvkfy
    ipdmnsrmagqysciyrvgelwsepsnlldlvvtemydtptlsvhpgpevisgekvtfyc
    rldtatsmflllkegrsshvqrgygkvqaefplgpvttahrgtyrcfgsynnhawsfpse
    pvkllvtg