PDB entry 1p6f

View 1p6f on RCSB PDB site
Description: Structure of the human natural cytotoxicity receptor NKp46
Class: immune system
Keywords: Natural cytotoxicity receptor, NKp46, NK cell receptor, immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2003-04-29, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: natural cytotoxicity triggering receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p6fa1, d1p6fa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p6fA (A:)
    qqqtlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkv
    kfyipdmnsrmagqysciyrvgelwsepsnlldlvvtemydtptlsvhpgpevisgekvt
    fycrldtatsmflllkegrsshvqrgygkvqaefplgpvttahrgtyrcfgsynnhawsf
    psepvkllvtgdientslapedptfpadtwgtyllttetglqkdhalwdhtaqnllrmgl
    af
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6fA (A:)
    tlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkvkfy
    ipdmnsrmagqysciyrvgelwsepsnlldlvvtemydtptlsvhpgpevisgekvtfyc
    rldtatsmflllkegrsshvqrgygkvqaefplgpvttahrgtyrcfgsynnhawsfpse
    pvkllvtg