PDB entry 1p6d

View 1p6d on RCSB PDB site
Description: structure of the d55n mutant of phospholipase c from bacillus cereus in complex with (3s)-3,4,di-n-hexanoyloxybutyl-1-phosphocholine
Class: hydrolase
Keywords: TRI ZN2+ METAL CORE, hydrolase
Deposited on 2003-04-29, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c
    Species: Bacillus cereus [TaxId:1396]
    Gene: plc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09598 (0-244)
      • engineered (54)
    Domains in SCOPe 2.08: d1p6da_
  • Heterogens: ZN, 3PC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p6dA (A:)
wsaedkhkegvnshlwivnraidimsrnttlvkqdrvaqlnewrtelengiyaanyenpy
ydnstfashfydpdngktyipfakqaketgakyfklagesyknkdmkqaffylglslhyl
gdvnqpmhaanftnlsypqgfhskyenfvdtikdnykvtdgngywnwkgtnpeewihgaa
vvakqdysgivndntkdwfvkaavsqeyadkwraevtpmtgkrlmdaqrvtagyiqlwfd
tygdr