PDB entry 1p6c

View 1p6c on RCSB PDB site
Description: crystal structure of phosphotriesterase triple mutant H254G/H257W/L303T complexed with diisopropylmethylphosphonate
Class: hydrolase
Keywords: metalloenzyme, tim barrel, nerve agent, HYDROLASE
Deposited on 2003-04-29, released 2003-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Flavobacterium sp. [TaxId:239]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A433
      • engineered (224)
      • engineered (227)
      • engineered (273)
    Domains in SCOPe 2.06: d1p6ca_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Flavobacterium sp. [TaxId:239]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A433
      • engineered (224)
      • engineered (227)
      • engineered (273)
    Domains in SCOPe 2.06: d1p6cb_
  • Heterogens: ZN, EBP, DII, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p6cA (A:)
    sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
    araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasas
    allgirswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6cA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallg
    irswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p6cB (B:)
    sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
    araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasas
    allgirswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6cB (B:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflsptlra