PDB entry 1p6b

View 1p6b on RCSB PDB site
Description: X-ray structure of phosphotriesterase, triple mutant H254G/H257W/L303T
Class: hydrolase
Keywords: metalloenzyme, tim barrel, nerve agents, HYDROLASE
Deposited on 2003-04-29, released 2003-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Flavobacterium sp. [TaxId:239]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A433
      • engineered (224)
      • engineered (227)
      • engineered (273)
    Domains in SCOPe 2.06: d1p6ba_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Flavobacterium sp. [TaxId:239]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A433
      • engineered (224)
      • engineered (227)
      • engineered (273)
    Domains in SCOPe 2.06: d1p6bb_
  • Heterogens: ZN, EBP, EFS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p6bA (A:)
    sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
    araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasas
    allgirswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6bA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallg
    irswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p6bB (B:)
    sigtgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrr
    araagvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqf
    flreiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasas
    allgirswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p6bB (B:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallg
    irswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlra