PDB entry 1p6a

View 1p6a on RCSB PDB site
Description: structural basis for variation in adenovirus affinity for the cellular receptor car (s489y mutant)
Class: Viral protein/receptor
Keywords: VIRUS, VIRAL PROTEIN, Viral protein-receptor COMPLEX
Deposited on 2003-04-29, released 2004-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus A [TaxId:28282]
    Gene: L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36711 (0-184)
      • engineered mutation (86)
    Domains in SCOPe 2.08: d1p6aa_
  • Chain 'B':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CXADR, CAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78310 (1-123)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1p6ab1, d1p6ab2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p6aA (A:)
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaywgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p6aB (B:)
gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga