PDB entry 1p68

View 1p68 on RCSB PDB site
Description: Solution structure of S-824, a de novo designed four helix bundle
Class: de novo protein
Keywords: Protein, four helix bundle, de novo design, DE NOVO PROTEIN
Deposited on 2003-04-29, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: De novo designed protein S-824
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 1P68 (0-101)
  Domains in SCOPe 2.08: d1p68a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p68A (A:)
  mygklndlledlqevlknlhknwhggkdnlhdvdnhlqnviedihdfmqgggsggklqem
  mkefqqvldelnnhlqggkhtvhhieqnikeifhhleelvhr