PDB entry 1p67

View 1p67 on RCSB PDB site
Description: nmr structure of the complex between alpha-bungarotoxin and mimotope of the nicotinic acetilcholine receptor with enhanced activity
Class: toxin
Keywords: neurotoxin, protein-peptide complex, alpha-bungarotoxin, beta-strands
Deposited on 2003-04-29, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-11-25, with a file datestamp of 2007-04-25.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: long neurotoxin 1
  Species: Bungarus multicinctus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01378 (0-73)
  Domains in SCOPe 2.06: d1p67a_
• Chain 'B':
  Compound: mimotope of the nicotinic acetilcholine receptor
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p67A (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg
  

  
  
• Chain 'B':
  No sequence available.