PDB entry 1p67

View 1p67 on RCSB PDB site
Description: nmr structure of the complex between alpha-bungarotoxin and mimotope of the nicotinic acetilcholine receptor with enhanced activity
Class: toxin
Keywords: neurotoxin, protein-peptide complex, alpha-bungarotoxin, beta-strands
Deposited on 2003-04-29, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-11-25, with a file datestamp of 2007-04-25.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: long neurotoxin 1
    Species: Bungarus multicinctus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p67a_
  • Chain 'B':
    Compound: mimotope of the nicotinic acetilcholine receptor
    Species:
    Gene:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p67A (A:)
    ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
    stdkcnphpkqrpg
    

  • Chain 'B':
    No sequence available.