PDB entry 1p63

View 1p63 on RCSB PDB site
Description: Human Acidic Fibroblast Growth Factor. 140 Amino Acid Form with Amino Terminal His Tag and Leu111 Replaced with Ile (L111I)
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-04-28, released 2004-05-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.22
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (114)
    Domains in SCOPe 2.04: d1p63a_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered (114)
    Domains in SCOPe 2.04: d1p63b_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p63A (A:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvgikkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p63A (A:)
    hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvgikkngsc
    krgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p63B (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvgikkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p63B (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvgikkngs
    ckrgprthygqkailflplpv