PDB entry 1p5v

View 1p5v on RCSB PDB site
Description: x-ray structure of the caf1m:caf1 chaperone:subunit preassembly complex
Deposited on 2003-04-28, released 2003-06-24
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p5vA (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5vA (A:)
    faskeygvtigesriiypldaagvmvsvkntqdypvliqsriydpfvvtpplfrldakqq
    nslriaqaggvfprdkeslkwlcvkgipkdvgvfvqfainncikllvrpnelkgtpiqfa
    enlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpnvswriindq
    ggldrlysknv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p5vB (B:)
    adltshhhhhhveparitltykegapitimdngnidtellvgtltlggyktgttstsvnf
    tdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdff
    vrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5vB (B:)
    veparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmylt
    ftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkl
    aagkytdavtvtvsnq