PDB entry 1p5u

View 1p5u on RCSB PDB site
Description: X-ray structure of the ternary Caf1M:Caf1:Caf1 chaperone:subunit:subunit complex
Class: chaperone, structural protein
Keywords: chaperone, chaperone-target complex, chaperone-subunit complex, protein fiber, donor strand complementation, donor strand exchange, STRUCTURAL PROTEIN
Deposited on 2003-04-28, released 2003-06-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.168
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1p5ua1, d1p5ua2
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: CAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26948 (0-148)
      • engineered (8)
    Domains in SCOPe 2.05: d1p5ub_
  • Chain 'C':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Gene: CAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1p5uc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p5uA (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5uA (A:)
    skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkepfvvtpplfrldak
    qqnslriaqaggvfprdkeslkwlcvkgippkdpdkdvgvfvqfainncikllvrpnelk
    gtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkgl
    agarnvswriindqggldrlysknvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p5uB (B:)
    adltasttrtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p5uC (C:)
    adltshhhhhhveparitltykegapitimdngnidtellvgtltlggyktgttstsvnf
    tdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdff
    vrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5uC (C:)
    paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
    sqdgnnhqfttkvigkdsrdfdispkvngendvvlatgsqdffvrsigskggklaagkyt
    davtvtvsnq