PDB entry 1p5t

View 1p5t on RCSB PDB site
Description: Crystal Structure of Dok1 PTB Domain
Class: signaling protein
Keywords: signaling protein
Deposited on 2003-04-28, released 2004-02-17
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.218
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Docking protein 1
    Species: MUS MUSCULUS
    Gene: mdok1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97465 (4-End)
      • cloning artifact (3)
      • modified residue (67)
    Domains in SCOP 1.75: d1p5ta_
  • Chain 'B':
    Compound: Docking protein 1
    Species: MUS MUSCULUS
    Gene: mdok1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97465 (4-End)
      • cloning artifact (3)
      • modified residue (67)
    Domains in SCOP 1.75: d1p5tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p5tA (A:)
    gshmgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllr
    rygrdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgkvgqaqdilrl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5tA (A:)
    mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
    rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p5tB (B:)
    gshmgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllr
    rygrdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgkvgqaqdilrl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p5tB (B:)
    mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
    rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq